PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_33924
Common NameKK1_034041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Nin-like
Protein Properties Length: 691aa    MW: 76795.9 Da    PI: 6.7404
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_33924genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK893.9e-28433484152
         RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    aek+isl  l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  C.cajan_33924 433 AEKTISLPLLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 484
                    589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.359423504IPR003035RWP-RK domain
PfamPF020427.0E-24437484IPR003035RWP-RK domain
SuperFamilySSF542779.57E-22585676No hitNo description
Gene3DG3DSA:3.10.20.2401.7E-22589671No hitNo description
PfamPF005642.3E-15590673IPR000270PB1 domain
PROSITE profilePS5174524.546590674IPR000270PB1 domain
SMARTSM006667.7E-25590674IPR000270PB1 domain
CDDcd064072.08E-37591673No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
MEYEGLVQNG AYGSLSEFFA PETDLIDELF VEGCWVETRV NSKSEWSMEA QIEESEVGKR  60
WWIGPRANPG PSTSVQERLV VAVGYLKEYA MNSIQVWVPA RTTRAQPPYA LGLDYGDATR  120
GFEFEDEWSP NPNIRFFRSD EQYDVRAGSL ALPVFERGTA ICLGFLQILM PNNPNLHNVC  180
HALQGVDFIN QNLNVPPGVT VKGFDELYEG ALNEIVQVLT CVCKAHKLPL GLTWAPCIQQ  240
GKSGCGHLKE LLGFQEACSQ CHLLGQGQGQ GVVGTAFTTT KPCFANDMSK ALPLAHHANM  300
FGLHAAVAIP LRSVSADFVL EFFLPRDCQD YKHILNSLSM LVQQACRSLH VVTVEEEFLL  360
PVAHEMESSS WIAHMMEAQT QQNGKGVSVS LEYLQEPKQE FKVTTNGNCN ENEESYGGRR  420
GGRKSGDKRR TKAEKTISLP LLRQYFAGSL KDAAKSIGVC PTTLKRICRQ HGITRWPSRK  480
IKKVGHTLRK LQVVIDSVQG AQGAIQIGSF YTSFPELSST TATASAVSQS SKNVNNNNDT  540
SENNQGQLGA TTFKSPTSSC NASIQLQAPH PIQCLEVPPL PQTSVWNTTT FRVKATFGDE  600
KIRFSLQPNW VFRDLQMEIA RRFNLNENIN NIQLKYLDDA REWVLLTCDA DLEECKDINR  660
SSHNRTIRLF LFQASPLNHA NAFGSGSPSY S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003523488.10.0PREDICTED: protein NLP2-like
RefseqXP_014629858.10.0PREDICTED: protein NLP2-like
TrEMBLA0A151RPI30.0A0A151RPI3_CAJCA; Uncharacterized protein
STRINGGLYMA04G00210.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.21e-136Nin-like family protein